PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g01380.3.p
Common NameBRADI_4g01380, LOC100833622
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 336aa    MW: 36759.2 Da    PI: 8.7447
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g01380.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.63.1e-31170226158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  Bradi4g01380.3.p 170 DAPIYVNAKQYEAILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 226
                       68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.4E-35168229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.736169229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-23172194IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.8E-28172226IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-23203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MMSFKNYEGF GSQLAAAAAS QAAGGAPLPP WWAPPQLLYG EPAGQVRSPA MFMSPEGACR  60
DGQFQVVPRA QSLLDAPPPQ QQTMTERGVS EGLKFSMAHG RGGKGSEHST TIALQSPFSE  120
YNDRFELGLG QTVLSSNYPY TDQQHGILSH YGMRSTPNGR MLIPLNMPAD APIYVNAKQY  180
EAILRRRRAR AKAEKENRLV KARKPYLHES RHLHAMRRAR GSGGRFLNTK KDINGKDAGE  240
GDKTLDSNPL MRLAASPSSE IQHSEQGNRS SISSLSGSEV TSLYEHEDVE HYNGFEQLRT  300
HFFTPLPSIM DGEHGAGNPF RWAAASDGCC DLLRA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A1e-17170228261HAPB protein
4g91_A1e-17170228261HAPB protein
4awl_A1e-17170230262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577268.10.0PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.10.0PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_014757443.10.0PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLI1IGB50.0I1IGB5_BRADI; Uncharacterized protein
STRINGBRADI4G01380.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Representative plantOGRP51361122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.13e-30nuclear factor Y, subunit A2